![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
![]() | Superfamily b.19.1: Viral protein domain [49818] (4 families) ![]() forms homotrimers |
![]() | Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
![]() | Protein automated matches [227017] (58 species) not a true protein |
![]() | Species Influenza A virus (a/shearwater/australia/2576/1979(h15n9)) [TaxId:650409] [333007] (2 PDB entries) |
![]() | Domain d5tg9a_: 5tg9 A: [333008] Other proteins in same PDB: d5tg9b_, d5tg9d_ automated match to d4xkga_ complexed with nag |
PDB Entry: 5tg9 (more details), 2.75 Å
SCOPe Domain Sequences for d5tg9a_:
Sequence, based on SEQRES records: (download)
>d5tg9a_ b.19.1.0 (A:) automated matches {Influenza A virus (a/shearwater/australia/2576/1979(h15n9)) [TaxId: 650409]} dkiclghhavangtkvntltergvevvnatetveitgidkvctkgkkavdlgscgilgti igppqcdlhlefkadliierrnssdicypgrftneealrqiiresggidkesmgfrysgi rtdgatsackrtvssfysemkwlsssmnnqvfpqlnqtyrntrkepalivwgvhhsssld eqnklygtgnklitvgsskyqqsfspspgarpkvngqagridfhwmlldpgdtvtftfng afiapdratflrsnapsgieyngkslgiqsdaqidescegecfysggtinsplpfqnids ravgkcpryvkqsslplalgmknvpeki
>d5tg9a_ b.19.1.0 (A:) automated matches {Influenza A virus (a/shearwater/australia/2576/1979(h15n9)) [TaxId: 650409]} dkiclghhavangtkvntltergvevvnatetveitgidkvctkgkkavdlgscgilgti igppqcdlhlefkadliierrnssdicypgrftneealrqiiresggidkesmgfrysgi rtdgatsackrtvssfysemkwlsssmnnqvfpqlnqtyrntrkepalivwgvhhsssld eqnklygtgnklitvgsskyqqsfspspgarpkvngqagridfhwmlldpgdtvtftfng afiapdratflrsnaieyngkslgiqsdaqidescegecfysggtinsplpfqnidsrav gkcpryvkqsslplalgmknvpeki
Timeline for d5tg9a_: