Class a: All alpha proteins [46456] (289 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.0: automated matches [191374] (1 protein) not a true family |
Protein automated matches [190453] (25 species) not a true protein |
Species Geobacter sulfurreducens [TaxId:243231] [226497] (6 PDB entries) |
Domain d5mcsa_: 5mcs A: [333004] automated match to d3cu4a_ complexed with hec |
PDB Entry: 5mcs (more details)
SCOPe Domain Sequences for d5mcsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mcsa_ a.3.1.0 (A:) automated matches {Geobacter sulfurreducens [TaxId: 243231]} agggelfathcagchpqggntvhpektlararreangirtvrdvaayirnpgpgmpafge amippadalkigeyvvasfp
Timeline for d5mcsa_: