Lineage for d5mcsa_ (5mcs A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304252Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2304253Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2305066Family a.3.1.0: automated matches [191374] (1 protein)
    not a true family
  6. 2305067Protein automated matches [190453] (25 species)
    not a true protein
  7. 2305082Species Geobacter sulfurreducens [TaxId:243231] [226497] (6 PDB entries)
  8. 2305096Domain d5mcsa_: 5mcs A: [333004]
    automated match to d3cu4a_
    complexed with hec

Details for d5mcsa_

PDB Entry: 5mcs (more details)

PDB Description: solution structure and dynamics of the outer membrane cytochrome omcf from geobacter sulfurreducens
PDB Compounds: (A:) Lipoprotein cytochrome c, 1 heme-binding site

SCOPe Domain Sequences for d5mcsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mcsa_ a.3.1.0 (A:) automated matches {Geobacter sulfurreducens [TaxId: 243231]}
agggelfathcagchpqggntvhpektlararreangirtvrdvaayirnpgpgmpafge
amippadalkigeyvvasfp

SCOPe Domain Coordinates for d5mcsa_:

Click to download the PDB-style file with coordinates for d5mcsa_.
(The format of our PDB-style files is described here.)

Timeline for d5mcsa_: