Lineage for d1es8a_ (1es8 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1371642Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 1371643Superfamily c.52.1: Restriction endonuclease-like [52980] (34 families) (S)
  5. 1371739Family c.52.1.5: Restriction endonuclease BglII [52993] (1 protein)
  6. 1371740Protein Restriction endonuclease BglII [52994] (1 species)
  7. 1371741Species Bacillus subtilis [TaxId:1423] [52995] (3 PDB entries)
  8. 1371746Domain d1es8a_: 1es8 A: [33299]
    free enzyme
    complexed with acy

Details for d1es8a_

PDB Entry: 1es8 (more details), 2.3 Å

PDB Description: Crystal structure of free BglII
PDB Compounds: (A:) restriction endonuclease bglii

SCOPe Domain Sequences for d1es8a_:

Sequence, based on SEQRES records: (download)

>d1es8a_ c.52.1.5 (A:) Restriction endonuclease BglII {Bacillus subtilis [TaxId: 1423]}
mkiditdynhadeilnpqlwkeieetllkmplhvkasdqaskvgslifdpvgtnqyikde
lvpkhwknnipipkrfdflgtdidfgkrdtlvevqfsnypfllnntvrselfhksnmdid
eegmkvaiiitkghmfpasnsslyyeqaqnqlnslaeynvfdvpirlvgliedfetdidi
vsttyadkrysrtitkrdtvkgkvidtntpntrrrkrgtivty

Sequence, based on observed residues (ATOM records): (download)

>d1es8a_ c.52.1.5 (A:) Restriction endonuclease BglII {Bacillus subtilis [TaxId: 1423]}
mkiditdynhadeilnpqlwkeieetllkmplhvkasslifdpvgtnqyikdelvpkhwk
nnipipkrfdflgtdidfgkrdtlvevqfsnypfllnntvrselfhkgmkvaiiitkghm
fpasnsslyyeqaqnqlnslaeynvfdvpirlvgliedfetdidivsttyadkysrtitk
rdtvkgkvidrgtivty

SCOPe Domain Coordinates for d1es8a_:

Click to download the PDB-style file with coordinates for d1es8a_.
(The format of our PDB-style files is described here.)

Timeline for d1es8a_: