SCOPe 2.08: Domain d5mgfa1: 5mgf A:1858-1971

Lineage for d5mgfa1 (5mgf A:1858-1971)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)

8. Domain d5mgfa1: 5mgf A:1858-1971 [332986]
   Other proteins in same PDB: d5mgfa2
   automated match to d3uv2a_
   complexed with 7mw

Details for d5mgfa1

PDB Entry: 5mgf, 1.9 Å

PDB Description: crystal structure of baz2b bromodomain in complex with 4-propionyl- pyrrole derivative 2

PDB Compounds: (A:) Bromodomain adjacent to zinc finger domain protein 2B

SCOPe Domain Sequences for d5mgfa1:

Sequence; same for both SEQRES and ATOM records:

>d5mgfa1 a.29.2.0 (A:1858-1971) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstirek
lssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfkv

Timeline for d5mgfa1:

• d5mgfa1 first appeared in SCOPe 2.06
  
• d5mgfa1 appears in SCOPe 2.07