| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
| Family a.39.1.0: automated matches [191396] (1 protein) not a true family |
| Protein automated matches [190513] (36 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [189519] (58 PDB entries) |
| Domain d5m6ca_: 5m6c A: [332978] automated match to d2d8na_ complexed with ca; mutant |
PDB Entry: 5m6c (more details), 3 Å
SCOPe Domain Sequences for d5m6ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5m6ca_ a.39.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sklrpemlqdlrentefselelqewykgflkdcptgilnvdefkkiyanffpygdaskfa
ehvfrnfdtnsdgtidfrefiialsvtsrgrleqklmwafsmydldgngyisreemleiv
qaiykmvssvmkmpedestpekrtekifrqmdtnndgklsleefirgaksdpsivrllqc
dps
Timeline for d5m6ca_: