Lineage for d5kyka1 (5kyk A:1-167)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2447791Family c.37.1.8: G proteins [52592] (80 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2448880Protein automated matches [190047] (29 species)
    not a true protein
  7. 2448966Species Human (Homo sapiens) [TaxId:9606] [186768] (178 PDB entries)
  8. 2449259Domain d5kyka1: 5kyk A:1-167 [332945]
    Other proteins in same PDB: d5kyka2, d5kykb2, d5kykc2
    automated match to d4obea_
    complexed with 6zd

Details for d5kyka1

PDB Entry: 5kyk (more details), 2.7 Å

PDB Description: covalent gtp-competitive inhibitors of kras g12c: guanosine bisphosphonate analogs
PDB Compounds: (A:) GTPase KRas

SCOPe Domain Sequences for d5kyka1:

Sequence, based on SEQRES records: (download)

>d5kyka1 c.37.1.8 (A:1-167) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgacgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl
psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk

Sequence, based on observed residues (ATOM records): (download)

>d5kyka1 c.37.1.8 (A:1-167) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgacgvgksaltiqliqnhfvdeyddsyrkqvvidgetclldildtagqerd
qymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdlpsrtvdtkq
aqdlarsygipfietsaktrqgvddafytlvreirkhk

SCOPe Domain Coordinates for d5kyka1:

Click to download the PDB-style file with coordinates for d5kyka1.
(The format of our PDB-style files is described here.)

Timeline for d5kyka1: