SCOPe 2.06: Domain d5j48a1: 5j48 A:219-351

Lineage for d5j48a1 (5j48 A:219-351)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.0: automated matches [227198] (1 protein)
   not a true family

6. Protein automated matches [226927] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [256346] (13 PDB entries)

8. Domain d5j48a1: 5j48 A:219-351 [332941]
   Other proteins in same PDB: d5j48a2, d5j48b2
   automated match to d4ku7a_
   complexed with 6fw, ca, edo, na

Details for d5j48a1

PDB Entry: 5j48, 1.49 Å

PDB Description: pkg i's carboyl terminal cyclic nucleotide binding domain (cnb-b) in a complex with 8-pcpt-cgmp

PDB Compounds: (A:) cGMP-dependent protein kinase 1

SCOPe Domain Sequences for d5j48a1:

Sequence, based on SEQRES records:

>d5j48a1 b.82.3.0 (A:219-351) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tglikhteymeflksvptfqslpeeilskladvleethyengeyiirqgargdtffiisk
gtvnvtredspsedpvflrtlgkgdwfgekalqgedvrtanviaaeavtclvidrdsfkh
ligglddvsnkay

Sequence, based on observed residues (ATOM records):

>d5j48a1 b.82.3.0 (A:219-351) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tglikhteymeflksvptfqslpeeilskladvleethyengeyiirqgargdtffiisk
gtvnvtreddpvflrtlgkgdwfgekalqgedvrtanviaaeavtclvidrdsfkhligg
lddvsnkay

Timeline for d5j48a1:

• d5j48a1 is new in SCOPe 2.06-stable
  
• d5j48a1 appears in SCOPe 2.07
  
• d5j48a1 appears in the current release, SCOPe 2.08