Lineage for d5j48a1 (5j48 A:219-351)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403751Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2405483Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2405722Family b.82.3.0: automated matches [227198] (1 protein)
    not a true family
  6. 2405723Protein automated matches [226927] (16 species)
    not a true protein
  7. 2405748Species Human (Homo sapiens) [TaxId:9606] [256346] (16 PDB entries)
  8. 2405752Domain d5j48a1: 5j48 A:219-351 [332941]
    Other proteins in same PDB: d5j48a2, d5j48b2
    automated match to d4ku7a_
    complexed with 6fw, ca, edo, na

Details for d5j48a1

PDB Entry: 5j48 (more details), 1.49 Å

PDB Description: pkg i's carboyl terminal cyclic nucleotide binding domain (cnb-b) in a complex with 8-pcpt-cgmp
PDB Compounds: (A:) cGMP-dependent protein kinase 1

SCOPe Domain Sequences for d5j48a1:

Sequence, based on SEQRES records: (download)

>d5j48a1 b.82.3.0 (A:219-351) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tglikhteymeflksvptfqslpeeilskladvleethyengeyiirqgargdtffiisk
gtvnvtredspsedpvflrtlgkgdwfgekalqgedvrtanviaaeavtclvidrdsfkh
ligglddvsnkay

Sequence, based on observed residues (ATOM records): (download)

>d5j48a1 b.82.3.0 (A:219-351) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tglikhteymeflksvptfqslpeeilskladvleethyengeyiirqgargdtffiisk
gtvnvtreddpvflrtlgkgdwfgekalqgedvrtanviaaeavtclvidrdsfkhligg
lddvsnkay

SCOPe Domain Coordinates for d5j48a1:

Click to download the PDB-style file with coordinates for d5j48a1.
(The format of our PDB-style files is described here.)

Timeline for d5j48a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5j48a2