Lineage for d5e1hb_ (5e1h B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2347168Protein automated matches [190119] (20 species)
    not a true protein
  7. 2348290Species Vicugna pacos [TaxId:30538] [189756] (42 PDB entries)
  8. 2348321Domain d5e1hb_: 5e1h B: [332940]
    Other proteins in same PDB: d5e1ha_
    automated match to d4ocmc_
    complexed with cl

Details for d5e1hb_

PDB Entry: 5e1h (more details), 2.03 Å

PDB Description: ricin toxin in complex with neutralizing single chain monoclonal antibodies (vhhs)
PDB Compounds: (B:) F8(JOB10) VHH antibody

SCOPe Domain Sequences for d5e1hb_:

Sequence, based on SEQRES records: (download)

>d5e1hb_ b.1.1.1 (B:) automated matches {Vicugna pacos [TaxId: 30538]}
vqlaetggglvqaggslrlscaasgttfsknamawfrqapgkerefvaginwnavstnya
dsvkgrftvsrdnakntvylqmnslkpedtavyycagssiysdisgaatvwatsynywgq
gtqvtvss

Sequence, based on observed residues (ATOM records): (download)

>d5e1hb_ b.1.1.1 (B:) automated matches {Vicugna pacos [TaxId: 30538]}
vqlaetggglvqaggslrlscaasgttfsknamawfrqakrefvaginwnavstnyasvk
grftvsrdnakntvylqmnslkpedtavyycagssiysdisgaatvwatsynywgqgtqv
tvss

SCOPe Domain Coordinates for d5e1hb_:

Click to download the PDB-style file with coordinates for d5e1hb_.
(The format of our PDB-style files is described here.)

Timeline for d5e1hb_: