SCOPe 2.08: Domain d5e1hb_: 5e1h B:

Lineage for d5e1hb_ (5e1h B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries)

8. Domain d5e1hb_: 5e1h B: [332940]
   Other proteins in same PDB: d5e1ha_
   automated match to d4ocmc_
   complexed with cl

Details for d5e1hb_

PDB Entry: 5e1h, 2.03 Å

PDB Description: ricin toxin in complex with neutralizing single chain monoclonal antibodies (vhhs)

PDB Compounds: (B:) F8(JOB10) VHH antibody

SCOPe Domain Sequences for d5e1hb_:

Sequence, based on SEQRES records:

>d5e1hb_ b.1.1.1 (B:) automated matches {Vicugna pacos [TaxId: 30538]}
vqlaetggglvqaggslrlscaasgttfsknamawfrqapgkerefvaginwnavstnya
dsvkgrftvsrdnakntvylqmnslkpedtavyycagssiysdisgaatvwatsynywgq
gtqvtvss

Sequence, based on observed residues (ATOM records):

>d5e1hb_ b.1.1.1 (B:) automated matches {Vicugna pacos [TaxId: 30538]}
vqlaetggglvqaggslrlscaasgttfsknamawfrqakrefvaginwnavstnyasvk
grftvsrdnakntvylqmnslkpedtavyycagssiysdisgaatvwatsynywgqgtqv
tvss

Timeline for d5e1hb_:

• d5e1hb_ first appeared in SCOPe 2.06
  
• d5e1hb_ appears in SCOPe 2.07