![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
![]() | Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families) ![]() |
![]() | Family c.52.1.4: Restriction endonuclease BglI [52990] (1 protein) |
![]() | Protein Restriction endonuclease BglI [52991] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [52992] (1 PDB entry) |
![]() | Domain d1dmua_: 1dmu A: [33294] protein/DNA complex; complexed with bme, ca |
PDB Entry: 1dmu (more details), 2.2 Å
SCOPe Domain Sequences for d1dmua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dmua_ c.52.1.4 (A:) Restriction endonuclease BglI {Bacillus subtilis [TaxId: 1423]} mynlhrekifmsynqnkqylednpeiqekielyglnllnevisdneeeiradyneanflh pfwmnyppldrgkmpkgdqipwievgekavgskltrlvsqreditvreiglptgpderyl ltsptiysltngftdsimmfvdiksvgprdsdydlvlspnqvsgngdwaqleggiqnnqq tiqgprssqiflptipplyilsdgtiapvvhlfikpiyamrsltkgdtgqslykiklasv pnglglfcnpgyafdsaykflfrpgkddrtksllqkrvrvdlrvldkigprvmtidmdk
Timeline for d1dmua_: