| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) ![]() |
| Family d.58.7.0: automated matches [191529] (1 protein) not a true family |
| Protein automated matches [190896] (11 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [189319] (9 PDB entries) |
| Domain d5lsld_: 5lsl D: [332937] automated match to d3mdfa_ protein/RNA complex |
PDB Entry: 5lsl (more details), 1.65 Å
SCOPe Domain Sequences for d5lsld_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lsld_ d.58.7.0 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gntvyvgnidpritkeqlyelfiqinpvlrikypkdkvlqayqgyafiefynqgdaqyai
kimnntvrlydrlikvrqv
Timeline for d5lsld_: