SCOPe 2.08: Domain d5k9ya_: 5k9y A:

Lineage for d5k9ya_ (5k9y A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein automated matches [190135] (18 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [332921] (1 PDB entry)

8. Domain d5k9ya_: 5k9y A: [332934]
   automated match to d2dcza_
   mutant

Details for d5k9ya_

PDB Entry: 5k9y, 2.2 Å

PDB Description: crystal structure of a thermophilic xylanase a from bacillus subtilis 1a1 quadruple mutant q7h/g13r/s22p/s179c

PDB Compounds: (A:) Endo-1,4-beta-xylanase A

SCOPe Domain Sequences for d5k9ya_:

Sequence; same for both SEQRES and ATOM records:

>d5k9ya_ b.29.1.11 (A:) automated matches {Bacillus subtilis [TaxId: 224308]}
astdywhnwtdgrgivnavngpggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
drttftqywsvrqskrptgsnatitfsnhvnawkshgmnlgsnwayqvmategyqssgcs
nvtvw

Timeline for d5k9ya_:

• d5k9ya_ first appeared in SCOPe 2.06
  
• d5k9ya_ appears in SCOPe 2.07