Class a: All alpha proteins [46456] (289 folds) |
Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.1: Spectrin repeat [46966] (2 families) |
Family a.7.1.0: automated matches [191601] (1 protein) not a true family |
Protein automated matches [191094] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189074] (2 PDB entries) |
Domain d5j4oa1: 5j4o A:7-117 [332932] automated match to d1u5pa1 complexed with edo, pg4 |
PDB Entry: 5j4o (more details), 1.54 Å
SCOPe Domain Sequences for d5j4oa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5j4oa1 a.7.1.0 (A:7-117) automated matches {Human (Homo sapiens) [TaxId: 9606]} easrqqrfntsirdfefwlseaetllamkdqardlasagnllkkhqlleremlaredalk dlntlaedllssgtfnvdqivkkkdnvnkrflnvqelaaahheklkeayal
Timeline for d5j4oa1: