Lineage for d5j4oa1 (5j4o A:7-117)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2309866Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2309867Superfamily a.7.1: Spectrin repeat [46966] (2 families) (S)
  5. 2309911Family a.7.1.0: automated matches [191601] (1 protein)
    not a true family
  6. 2309912Protein automated matches [191094] (1 species)
    not a true protein
  7. 2309913Species Human (Homo sapiens) [TaxId:9606] [189074] (2 PDB entries)
  8. 2309914Domain d5j4oa1: 5j4o A:7-117 [332932]
    automated match to d1u5pa1
    complexed with edo, pg4

Details for d5j4oa1

PDB Entry: 5j4o (more details), 1.54 Å

PDB Description: structure of human erythrocytic spectrin alpha chain repeats 16-17
PDB Compounds: (A:) Spectrin alpha chain, erythrocytic 1

SCOPe Domain Sequences for d5j4oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j4oa1 a.7.1.0 (A:7-117) automated matches {Human (Homo sapiens) [TaxId: 9606]}
easrqqrfntsirdfefwlseaetllamkdqardlasagnllkkhqlleremlaredalk
dlntlaedllssgtfnvdqivkkkdnvnkrflnvqelaaahheklkeayal

SCOPe Domain Coordinates for d5j4oa1:

Click to download the PDB-style file with coordinates for d5j4oa1.
(The format of our PDB-style files is described here.)

Timeline for d5j4oa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5j4oa2