SCOPe 2.06: Domain d5j4oa1: 5j4o A:7-117

Lineage for d5j4oa1 (5j4o A:7-117)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.1: Spectrin repeat [46966] (2 families)

5. Family a.7.1.0: automated matches [191601] (1 protein)
   not a true family

6. Protein automated matches [191094] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189074] (2 PDB entries)

8. Domain d5j4oa1: 5j4o A:7-117 [332932]
   automated match to d1u5pa1
   complexed with edo, pg4

Details for d5j4oa1

PDB Entry: 5j4o, 1.54 Å

PDB Description: structure of human erythrocytic spectrin alpha chain repeats 16-17

PDB Compounds: (A:) Spectrin alpha chain, erythrocytic 1

SCOPe Domain Sequences for d5j4oa1:

Sequence; same for both SEQRES and ATOM records:

>d5j4oa1 a.7.1.0 (A:7-117) automated matches {Human (Homo sapiens) [TaxId: 9606]}
easrqqrfntsirdfefwlseaetllamkdqardlasagnllkkhqlleremlaredalk
dlntlaedllssgtfnvdqivkkkdnvnkrflnvqelaaahheklkeayal

Timeline for d5j4oa1:

• d5j4oa1 is new in SCOPe 2.06-stable
  
• d5j4oa1 appears in SCOPe 2.07
  
• d5j4oa1 appears in the current release, SCOPe 2.08