SCOP 1.69: Domain d2bamb_: 2bam B:

Lineage for d2bamb_ (2bam B:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (23 families)

5. Family c.52.1.3: Restriction endonuclease BamHI [52987] (1 protein)

6. Protein Restriction endonuclease BamHI [52988] (1 species)

7. Species Bacillus amyloliquefaciens [TaxId:1390] [52989] (5 PDB entries)

8. Domain d2bamb_: 2bam B: [33293]

Details for d2bamb_

PDB Entry: 2bam, 2 Å

PDB Description: restriction endonuclease bamhi complex with dna and calcium ions (pre-reactive complex).

SCOP Domain Sequences for d2bamb_:

Sequence; same for both SEQRES and ATOM records:

>d2bamb_ c.52.1.3 (B:) Restriction endonuclease BamHI {Bacillus amyloliquefaciens}
mevekefitdeakellskdkliqqaynevktsicspiwpatsktftinntekncngvvpi
kelcytlledtynwyrekpldilklekkkggpidvykefienselkrvgmefetgnissa
hrsmnklllglkhgeidlaiilmpikqlayyltdrvtnfeelepyfeltegqpfifigfn
aeaynsnvplipkgsdgmskrsikkwkdkv

Timeline for d2bamb_:

• d2bamb_ first appeared (with stable ids) in SCOP 1.55
  
• d2bamb_ appears in SCOP 1.67
  
• d2bamb_ appears in SCOP 1.71
  
• d2bamb_ appears in the current release, SCOPe 2.08