![]() | Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
![]() | Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
![]() | Superfamily c.52.1: Restriction endonuclease-like [52980] (20 families) ![]() |
![]() | Family c.52.1.3: Restriction endonuclease BamHI [52987] (1 protein) |
![]() | Protein Restriction endonuclease BamHI [52988] (1 species) |
![]() | Species Bacillus amyloliquefaciens [TaxId:1390] [52989] (5 PDB entries) |
![]() | Domain d2bamb_: 2bam B: [33293] protein/DNA complex; complexed with ca |
PDB Entry: 2bam (more details), 2 Å
SCOP Domain Sequences for d2bamb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bamb_ c.52.1.3 (B:) Restriction endonuclease BamHI {Bacillus amyloliquefaciens} mevekefitdeakellskdkliqqaynevktsicspiwpatsktftinntekncngvvpi kelcytlledtynwyrekpldilklekkkggpidvykefienselkrvgmefetgnissa hrsmnklllglkhgeidlaiilmpikqlayyltdrvtnfeelepyfeltegqpfifigfn aeaynsnvplipkgsdgmskrsikkwkdkv
Timeline for d2bamb_: