SCOPe 2.07: Domain d5j3nb1: 5j3n B:8-238

Lineage for d5j3nb1 (5j3n B:8-238)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (22 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [317895] (2 PDB entries)

8. Domain d5j3nb1: 5j3n B:8-238 [332927]
   Other proteins in same PDB: d5j3nb2
   automated match to d3st2a_

Details for d5j3nb1

PDB Entry: 5j3n, 2.45 Å

PDB Description: c-terminal domain of ecor124i hsdr subunit fused with the ph-sensitive gfp variant ratiometric phluorin

PDB Compounds: (B:) Green fluorescent protein,HsdR

SCOPe Domain Sequences for d5j3nb1:

Sequence; same for both SEQRES and ATOM records:

>d5j3nb1 d.22.1.1 (B:8-238) automated matches {Escherichia coli [TaxId: 562]}
skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
ttfsygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvn
rielkgidfkddgnilghkleynynehlvyimadkqkngtkaifqvhhniedggvqladh
yqqntpigdgpvllpdnhylhtqsalskdpnekrdhmvllefvtaagithg

Timeline for d5j3nb1:

• d5j3nb1 first appeared in SCOPe 2.06
  
• d5j3nb1 appears in the current release, SCOPe 2.08