Lineage for d5j3nb1 (5j3n B:8-238)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2184480Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2184481Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2184482Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2184772Protein automated matches [190406] (19 species)
    not a true protein
  7. 2184952Species Escherichia coli [TaxId:562] [317895] (2 PDB entries)
  8. 2184957Domain d5j3nb1: 5j3n B:8-238 [332927]
    Other proteins in same PDB: d5j3nb2
    automated match to d3st2a_

Details for d5j3nb1

PDB Entry: 5j3n (more details), 2.45 Å

PDB Description: c-terminal domain of ecor124i hsdr subunit fused with the ph-sensitive gfp variant ratiometric phluorin
PDB Compounds: (B:) Green fluorescent protein,HsdR

SCOPe Domain Sequences for d5j3nb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j3nb1 d.22.1.1 (B:8-238) automated matches {Escherichia coli [TaxId: 562]}
skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
ttfsygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvn
rielkgidfkddgnilghkleynynehlvyimadkqkngtkaifqvhhniedggvqladh
yqqntpigdgpvllpdnhylhtqsalskdpnekrdhmvllefvtaagithg

SCOPe Domain Coordinates for d5j3nb1:

Click to download the PDB-style file with coordinates for d5j3nb1.
(The format of our PDB-style files is described here.)

Timeline for d5j3nb1: