Lineage for d5k9yb_ (5k9y B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780055Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 2780261Protein automated matches [190135] (18 species)
    not a true protein
  7. 2780279Species Bacillus subtilis [TaxId:224308] [332921] (1 PDB entry)
  8. 2780281Domain d5k9yb_: 5k9y B: [332922]
    automated match to d2dcza_
    mutant

Details for d5k9yb_

PDB Entry: 5k9y (more details), 2.2 Å

PDB Description: crystal structure of a thermophilic xylanase a from bacillus subtilis 1a1 quadruple mutant q7h/g13r/s22p/s179c
PDB Compounds: (B:) Endo-1,4-beta-xylanase A

SCOPe Domain Sequences for d5k9yb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k9yb_ b.29.1.11 (B:) automated matches {Bacillus subtilis [TaxId: 224308]}
astdywhnwtdgrgivnavngpggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
drttftqywsvrqskrptgsnatitfsnhvnawkshgmnlgsnwayqvmategyqssgcs
nvtvw

SCOPe Domain Coordinates for d5k9yb_:

Click to download the PDB-style file with coordinates for d5k9yb_.
(The format of our PDB-style files is described here.)

Timeline for d5k9yb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5k9ya_