| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins) |
| Protein automated matches [190135] (18 species) not a true protein |
| Species Bacillus subtilis [TaxId:224308] [332921] (1 PDB entry) |
| Domain d5k9yb_: 5k9y B: [332922] automated match to d2dcza_ mutant |
PDB Entry: 5k9y (more details), 2.2 Å
SCOPe Domain Sequences for d5k9yb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5k9yb_ b.29.1.11 (B:) automated matches {Bacillus subtilis [TaxId: 224308]}
astdywhnwtdgrgivnavngpggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
drttftqywsvrqskrptgsnatitfsnhvnawkshgmnlgsnwayqvmategyqssgcs
nvtvw
Timeline for d5k9yb_: