SCOPe 2.06: Domain d5ki2a_: 5ki2 A:

Lineage for d5ki2a_ (5ki2 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.3: Phage lysozyme [53981] (4 proteins)

6. Protein automated matches [193860] (2 species)
   not a true protein

7. Species Enterobacteria phage [TaxId:10665] [193861] (22 PDB entries)

8. Domain d5ki2a_: 5ki2 A: [332920]
   automated match to d4pjza_
   complexed with hed; mutant

Details for d5ki2a_

PDB Entry: 5ki2, 1.5 Å

PDB Description: pseudo t4 lysozyme mutant - y18phe-methyl

PDB Compounds: (A:) endolysin

SCOPe Domain Sequences for d5ki2a_:

Sequence; same for both SEQRES and ATOM records:

>d5ki2a_ d.2.1.3 (A:) automated matches {Enterobacteria phage [TaxId: 10665]}
mnifemlrideglrlkifkdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk

Timeline for d5ki2a_:

• d5ki2a_ is new in SCOPe 2.06-stable
  
• d5ki2a_ appears in SCOPe 2.07
  
• d5ki2a_ appears in the current release, SCOPe 2.08