Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families) |
Family c.52.1.3: Restriction endonuclease BamHI [52987] (1 protein) automatically mapped to Pfam PF02923 |
Protein Restriction endonuclease BamHI [52988] (1 species) |
Species Bacillus amyloliquefaciens [TaxId:1390] [52989] (5 PDB entries) |
Domain d2bama_: 2bam A: [33292] protein/DNA complex; complexed with ca |
PDB Entry: 2bam (more details), 2 Å
SCOPe Domain Sequences for d2bama_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bama_ c.52.1.3 (A:) Restriction endonuclease BamHI {Bacillus amyloliquefaciens [TaxId: 1390]} mevekefitdeakellskdkliqqaynevktsicspiwpatsktftinntekncngvvpi kelcytlledtynwyrekpldilklekkkggpidvykefienselkrvgmefetgnissa hrsmnklllglkhgeidlaiilmpikqlayyltdrvtnfeelepyfeltegqpfifigfn aeaynsnvplipkgsdgmskrsikkwk
Timeline for d2bama_: