Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) same topology as (b.1.15.1) |
Family b.1.30.0: automated matches [254306] (1 protein) not a true family |
Protein automated matches [254707] (4 species) not a true protein |
Species Pig (Sus scrofa) [TaxId:9823] [311379] (18 PDB entries) |
Domain d5lg6a3: 5lg6 A:545-633 [332918] Other proteins in same PDB: d5lg6a1, d5lg6a2, d5lg6a4, d5lg6b1, d5lg6b2, d5lg6b4 automated match to d4fkha3 complexed with nag, zn |
PDB Entry: 5lg6 (more details), 2.5 Å
SCOPe Domain Sequences for d5lg6a3:
Sequence, based on SEQRES records: (download)
>d5lg6a3 b.1.30.0 (A:545-633) automated matches {Pig (Sus scrofa) [TaxId: 9823]} fpvitvdtktgnisqkhflldsesnvtrssafdylwivpissikngvmqdhywlrdvsqa qndlfktasddwvllnvnvtgyfqvnyde
>d5lg6a3 b.1.30.0 (A:545-633) automated matches {Pig (Sus scrofa) [TaxId: 9823]} fpvitvdtktgnisqkhfllafdylwivpissikngvmqdhywlrdvsqaqndlfktasd dwvllnvnvtgyfqvnyde
Timeline for d5lg6a3:
View in 3D Domains from other chains: (mouse over for more information) d5lg6b1, d5lg6b2, d5lg6b3, d5lg6b4 |