Lineage for d5lg6a3 (5lg6 A:545-633)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2376781Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) (S)
    same topology as (b.1.15.1)
  5. 2376803Family b.1.30.0: automated matches [254306] (1 protein)
    not a true family
  6. 2376804Protein automated matches [254707] (4 species)
    not a true protein
  7. 2376848Species Pig (Sus scrofa) [TaxId:9823] [311379] (18 PDB entries)
  8. 2376868Domain d5lg6a3: 5lg6 A:545-633 [332918]
    Other proteins in same PDB: d5lg6a1, d5lg6a2, d5lg6a4, d5lg6b1, d5lg6b2, d5lg6b4
    automated match to d4fkha3
    complexed with nag, zn

Details for d5lg6a3

PDB Entry: 5lg6 (more details), 2.5 Å

PDB Description: structure of the deglycosylated porcine aminopeptidase n ectodomain
PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d5lg6a3:

Sequence, based on SEQRES records: (download)

>d5lg6a3 b.1.30.0 (A:545-633) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
fpvitvdtktgnisqkhflldsesnvtrssafdylwivpissikngvmqdhywlrdvsqa
qndlfktasddwvllnvnvtgyfqvnyde

Sequence, based on observed residues (ATOM records): (download)

>d5lg6a3 b.1.30.0 (A:545-633) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
fpvitvdtktgnisqkhfllafdylwivpissikngvmqdhywlrdvsqaqndlfktasd
dwvllnvnvtgyfqvnyde

SCOPe Domain Coordinates for d5lg6a3:

Click to download the PDB-style file with coordinates for d5lg6a3.
(The format of our PDB-style files is described here.)

Timeline for d5lg6a3: