Lineage for d5j4ua1 (5j4u A:3-84)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2455315Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2455316Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2457558Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2457559Protein automated matches [190056] (171 species)
    not a true protein
  7. 2458870Species Western balsam poplar (Populus trichocarpa) [TaxId:3694] [186776] (11 PDB entries)
  8. 2458871Domain d5j4ua1: 5j4u A:3-84 [332906]
    Other proteins in same PDB: d5j4ua2
    automated match to d5agya1
    complexed with gsh

Details for d5j4ua1

PDB Entry: 5j4u (more details), 1.25 Å

PDB Description: crystal structure of a glutathione s-transferase ptgstu30 from populus trichocarpa in complex with gsh
PDB Compounds: (A:) Glutathione transferase family protein

SCOPe Domain Sequences for d5j4ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j4ua1 c.47.1.0 (A:3-84) automated matches {Western balsam poplar (Populus trichocarpa) [TaxId: 3694]}
sdqvtlldfwpspfgmrvrlalaekgvkyeyseedlrnksalllqmnpvnkqipvlvhng
kpvcesliivqyidevwkdsap

SCOPe Domain Coordinates for d5j4ua1:

Click to download the PDB-style file with coordinates for d5j4ua1.
(The format of our PDB-style files is described here.)

Timeline for d5j4ua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5j4ua2