Lineage for d5jihb2 (5jih B:340-443)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2028025Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)
  7. 2028028Species Human (Homo sapiens) [TaxId:9606] [88590] (67 PDB entries)
    Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region
  8. 2028039Domain d5jihb2: 5jih B:340-443 [332905]
    Other proteins in same PDB: d5jiha1, d5jihb1
    automated match to d4dz8a2
    complexed with bma, fuc, man, nag

Details for d5jihb2

PDB Entry: 5jih (more details), 1.66 Å

PDB Description: crystal structure of her2 binding igg1-fc (fcab stab19)
PDB Compounds: (B:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d5jihb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jihb2 b.1.1.2 (B:340-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]}
kgqprepqvytlppsrdeylsdsvsltclvkgfypsdiavewesngqpennykttppvld
sdgsfflyskltvprhsetmrrwahgnvfscsvmhealhnhytqkslsl

SCOPe Domain Coordinates for d5jihb2:

Click to download the PDB-style file with coordinates for d5jihb2.
(The format of our PDB-style files is described here.)

Timeline for d5jihb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5jihb1