Lineage for d5j4qb_ (5j4q B:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2257050Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2258855Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (2 families) (S)
  5. 2258856Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (2 proteins)
  6. 2258857Protein Bowman-Birk inhibitor, BBI [57249] (8 species)
    duplication: consists of two sequence repeats each having this fold
  7. 2258874Species Soybean (Glycine max) [TaxId:3847] [57251] (5 PDB entries)
  8. 2258876Domain d5j4qb_: 5j4q B: [332903]
    Other proteins in same PDB: d5j4qa_
    automated match to d2bbia_

Details for d5j4qb_

PDB Entry: 5j4q (more details), 2.3 Å

PDB Description: alpha-chymotrypsin from bovine pancreas in complex with bowman-birk inhibitor from soybean
PDB Compounds: (B:) bowman-birk type proteinase inhibitor

SCOPe Domain Sequences for d5j4qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j4qb_ g.3.13.1 (B:) Bowman-Birk inhibitor, BBI {Soybean (Glycine max) [TaxId: 3847]}
pccdqcactksnppqcrcsdmrlnschsackscicalsypaqcfcvditdfcyepckpse
ddke

SCOPe Domain Coordinates for d5j4qb_:

Click to download the PDB-style file with coordinates for d5j4qb_.
(The format of our PDB-style files is described here.)

Timeline for d5j4qb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5j4qa_