Lineage for d5j7na_ (5j7n A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2046032Fold b.15: HSP20-like chaperones [49763] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2046033Superfamily b.15.1: HSP20-like chaperones [49764] (5 families) (S)
  5. 2046136Family b.15.1.0: automated matches [191643] (1 protein)
    not a true family
  6. 2046137Protein automated matches [191181] (7 species)
    not a true protein
  7. 2046177Species Xylella fastidiosa [TaxId:160492] [332901] (1 PDB entry)
  8. 2046178Domain d5j7na_: 5j7n A: [332902]
    automated match to d1gmed_

Details for d5j7na_

PDB Entry: 5j7n (more details), 2.9 Å

PDB Description: crystal structure of a small heat-shock protein from xylella fastidiosa reveals a distinct high order structure
PDB Compounds: (A:) Low molecular weight heat shock protein

SCOPe Domain Sequences for d5j7na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j7na_ b.15.1.0 (A:) automated matches {Xylella fastidiosa [TaxId: 160492]}
aqwvprvdikeepnqfvlyadlpgidpadievqmdkgilsikgerktesssqtehfsrie
rrygsfhrrfalpdsadadgitasgshgvlsifipkraattprriqvgn

SCOPe Domain Coordinates for d5j7na_:

Click to download the PDB-style file with coordinates for d5j7na_.
(The format of our PDB-style files is described here.)

Timeline for d5j7na_: