SCOPe 2.08: Domain d5j7na_: 5j7n A:

Lineage for d5j7na_ (5j7n A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.15: HSP20-like chaperones [49763] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.15.1: HSP20-like chaperones [49764] (5 families)

5. Family b.15.1.0: automated matches [191643] (1 protein)
   not a true family

6. Protein automated matches [191181] (10 species)
   not a true protein

7. Species Xylella fastidiosa [TaxId:160492] [332901] (1 PDB entry)

8. Domain d5j7na_: 5j7n A: [332902]
   automated match to d1gmed_

Details for d5j7na_

PDB Entry: 5j7n, 2.9 Å

PDB Description: crystal structure of a small heat-shock protein from xylella fastidiosa reveals a distinct high order structure

PDB Compounds: (A:) Low molecular weight heat shock protein

SCOPe Domain Sequences for d5j7na_:

Sequence; same for both SEQRES and ATOM records:

>d5j7na_ b.15.1.0 (A:) automated matches {Xylella fastidiosa [TaxId: 160492]}
aqwvprvdikeepnqfvlyadlpgidpadievqmdkgilsikgerktesssqtehfsrie
rrygsfhrrfalpdsadadgitasgshgvlsifipkraattprriqvgn

Timeline for d5j7na_:

• d5j7na_ first appeared in SCOPe 2.06
  
• d5j7na_ appears in SCOPe 2.07