Lineage for d5j5nb2 (5j5n B:85-220)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2714314Species Western balsam poplar (Populus trichocarpa) [TaxId:3694] [326861] (11 PDB entries)
  8. 2714326Domain d5j5nb2: 5j5n B:85-220 [332897]
    Other proteins in same PDB: d5j5na1, d5j5nb1
    automated match to d5agya2
    complexed with gsh; mutant

Details for d5j5nb2

PDB Entry: 5j5n (more details), 2.63 Å

PDB Description: crystal structure of the r39w mutant of populus trichocarpa glutathione transferase ptgstu30 in complex with glutathione
PDB Compounds: (B:) Glutathione transferase family protein

SCOPe Domain Sequences for d5j5nb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j5nb2 a.45.1.0 (B:85-220) automated matches {Western balsam poplar (Populus trichocarpa) [TaxId: 3694]}
llpsdpyqraqsrfwadfvdkkiydlgrkiwtkkgeeqeaakkdfidslklmegelgdkp
yfggetigyvdialvpfyswfyayetignfnieaecpkmiayckrclqketvskaledpq
kvydfvlmlmkkfgie

SCOPe Domain Coordinates for d5j5nb2:

Click to download the PDB-style file with coordinates for d5j5nb2.
(The format of our PDB-style files is described here.)

Timeline for d5j5nb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5j5nb1