| Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
| Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.1: Restriction endonuclease-like [52980] (22 families) ![]() |
| Family c.52.1.3: Restriction endonuclease BamHI [52987] (1 protein) |
| Protein Restriction endonuclease BamHI [52988] (1 species) |
| Species Bacillus amyloliquefaciens [TaxId:1390] [52989] (5 PDB entries) |
| Domain d3bamb_: 3bam B: [33289] protein/DNA complex; complexed with mn |
PDB Entry: 3bam (more details), 1.8 Å
SCOP Domain Sequences for d3bamb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bamb_ c.52.1.3 (B:) Restriction endonuclease BamHI {Bacillus amyloliquefaciens}
mevekefitdeakellskdkliqqaynevktsicspiwpatsktftinntekncngvvpi
kelcytlledtynwyrekpldilklekkkggpidvykefienselkrvgmefetgnissa
hrsmnklllglkhgeidlaiilmpikqlayyltdrvtnfeelepyfeltegqpfifigfn
aeaynsnvplipkgsdgmskrsikkwkdk
Timeline for d3bamb_: