Lineage for d5g30b_ (5g30 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876128Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2876445Protein automated matches [190442] (13 species)
    not a true protein
  7. 2876494Species Pacific white shrimp (Litopenaeus vannamei) [TaxId:6689] [197071] (10 PDB entries)
  8. 2876506Domain d5g30b_: 5g30 B: [332885]
    automated match to d4aj8a_
    complexed with act, peg; mutant

Details for d5g30b_

PDB Entry: 5g30 (more details), 1.65 Å

PDB Description: crystallographic structure of mutant d60s of thioredoxin from litopenaeus vannamei
PDB Compounds: (B:) thioredoxin

SCOPe Domain Sequences for d5g30b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g30b_ c.47.1.1 (B:) automated matches {Pacific white shrimp (Litopenaeus vannamei) [TaxId: 6689]}
mvyqvkdqedftkqlneagnklvvidfyatwcgpckmiapkleelsqsmsdvvflkvdvs
ecediaqdnqiacmptflfmkngqkldslsganydkllelveknk

SCOPe Domain Coordinates for d5g30b_:

Click to download the PDB-style file with coordinates for d5g30b_.
(The format of our PDB-style files is described here.)

Timeline for d5g30b_: