SCOPe 2.08: Domain d5b4ml1: 5b4m L:1-111

Lineage for d5b4ml1 (5b4m L:1-111)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d5b4ml1: 5b4m L:1-111 [332882]
   Other proteins in same PDB: d5b4md2, d5b4ml2
   automated match to d1a5fl1

Details for d5b4ml1

PDB Entry: 5b4m, 2.4 Å

PDB Description: crystal structure of an fab against human influenza a

PDB Compounds: (L:) Fab light chain

SCOPe Domain Sequences for d5b4ml1:

Sequence; same for both SEQRES and ATOM records:

>d5b4ml1 b.1.1.0 (L:1-111) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divltqspaslavslgqratisckasqsvdydgdsyvtwyqqkpgqppklliyvasnles
giparfsgsgsgtdftlnihpveeedaatyycqqsnedpwtfgggtkleik

Timeline for d5b4ml1:

• d5b4ml1 first appeared in SCOPe 2.06
  
• d5b4ml1 appears in SCOPe 2.07