Lineage for d3bama_ (3bam A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 585880Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 585881Superfamily c.52.1: Restriction endonuclease-like [52980] (30 families) (S)
  5. 585952Family c.52.1.3: Restriction endonuclease BamHI [52987] (1 protein)
  6. 585953Protein Restriction endonuclease BamHI [52988] (1 species)
  7. 585954Species Bacillus amyloliquefaciens [TaxId:1390] [52989] (5 PDB entries)
  8. 585958Domain d3bama_: 3bam A: [33288]

Details for d3bama_

PDB Entry: 3bam (more details), 1.8 Å

PDB Description: restriction endonuclease bamhi complex with dna and manganese ions (post-reactive complex)

SCOP Domain Sequences for d3bama_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bama_ c.52.1.3 (A:) Restriction endonuclease BamHI {Bacillus amyloliquefaciens}
mevekefitdeakellskdkliqqaynevktsicspiwpatsktftinntekncngvvpi
kelcytlledtynwyrekpldilklekkkggpidvykefienselkrvgmefetgnissa
hrsmnklllglkhgeidlaiilmpikqlayyltdrvtnfeelepyfeltegqpfifigfn
aeaynsnvplipkgsdgmskrsikkw

SCOP Domain Coordinates for d3bama_:

Click to download the PDB-style file with coordinates for d3bama_.
(The format of our PDB-style files is described here.)

Timeline for d3bama_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3bamb_