SCOPe 2.08: Domain d5ksva2: 5ksv A:82-180

Lineage for d5ksva2 (5ksv A:82-180)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d5ksva2: 5ksv A:82-180 [332869]
   Other proteins in same PDB: d5ksva1, d5ksvb1, d5ksvb2
   automated match to d4ozfa2

Details for d5ksva2

PDB Entry: 5ksv, 2.2 Å

PDB Description: crystal structure of hla-dq2.5-clip2

PDB Compounds: (A:) MHC class II HLA-DQ-alpha chain

SCOPe Domain Sequences for d5ksva2:

Sequence; same for both SEQRES and ATOM records:

>d5ksva2 b.1.1.2 (A:82-180) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atnevpevtvfskspvtlgqpniliclvdnifppvvnitwlsnghsvtegvsetsflsks
dhsffkisyltllpsaeesydckvehwgldkpllkhwep

Timeline for d5ksva2:

• d5ksva2 first appeared in SCOPe 2.06
  
• d5ksva2 appears in SCOPe 2.07