SCOPe 2.08: Domain d5th1f_: 5th1 F:

Lineage for d5th1f_ (5th1 F:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (29 species)
   not a true protein

7. Species Influenza A virus, different strains [TaxId:11320] [255822] (26 PDB entries)

8. Domain d5th1f_: 5th1 F: [332866]
   Other proteins in same PDB: d5th1a_, d5th1c_, d5th1e_
   automated match to d3m5jb_
   complexed with nag; mutant

Details for d5th1f_

PDB Entry: 5th1, 2.19 Å

PDB Description: crystal structure of h10 hemagglutinin mutant (k158aa-q226l-g228s) from jiangxi-donghu (2013) h10n8 influenza virus in complex with 6'- slnln

PDB Compounds: (F:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d5th1f_:

Sequence, based on SEQRES records:

>d5th1f_ h.3.1.1 (F:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
lfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektnt
efesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlyer
vrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln

Sequence, based on observed residues (ATOM records):

>d5th1f_ h.3.1.1 (F:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
lfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlveknte
fesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlyerv
rkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln

Timeline for d5th1f_:

• d5th1f_ first appeared in SCOPe 2.06
  
• d5th1f_ appears in SCOPe 2.07