SCOPe 2.08: Domain d5uvma1: 5uvm A:2-114

Lineage for d5uvma1 (5uvm A:2-114)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.13: HIT-like [54196] (2 superfamilies)
   alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha

4. Superfamily d.13.1: HIT-like [54197] (6 families)

5. Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 proteins)
   Pfam PF01230
   topologically similar to the N-terminal domain of protein kinases

6. Protein Putative hydrolase [117791] (1 species)

7. Species Ruminiclostridium thermocellum [TaxId:637887] [332789] (1 PDB entry)

8. Domain d5uvma1: 5uvm A:2-114 [332860]
   Other proteins in same PDB: d5uvma2, d5uvmb2
   automated match to d1xqub_
   complexed with adn, unx, zn

Details for d5uvma1

PDB Entry: 5uvm, 2.3 Å

PDB Description: hit family hydrolase from clostridium thermocellum cth-393

PDB Compounds: (A:) Histidine triad (HIT) protein

SCOPe Domain Sequences for d5uvma1:

Sequence; same for both SEQRES and ATOM records:

>d5uvma1 d.13.1.1 (A:2-114) Putative hydrolase {Ruminiclostridium thermocellum [TaxId: 637887]}
encvfckiikrelpstiyyederviaikdinpaapvhvliipkehianvkeinesnaqil
idihkaankvaedlgiaekgyrlitncgvaagqtvfhlhyhllggvdmgpkil

Timeline for d5uvma1:

• d5uvma1 first appeared in SCOPe 2.06
  
• d5uvma1 appears in SCOPe 2.07