Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.13: HIT-like [54196] (2 superfamilies) alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha |
Superfamily d.13.1: HIT-like [54197] (6 families) |
Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 proteins) Pfam PF01230 topologically similar to the N-terminal domain of protein kinases |
Protein Putative hydrolase [117791] (1 species) |
Species Ruminiclostridium thermocellum [TaxId:637887] [332789] (1 PDB entry) |
Domain d5uvma1: 5uvm A:2-114 [332860] Other proteins in same PDB: d5uvma2, d5uvmb2 automated match to d1xqub_ complexed with adn, unx, zn |
PDB Entry: 5uvm (more details), 2.3 Å
SCOPe Domain Sequences for d5uvma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5uvma1 d.13.1.1 (A:2-114) Putative hydrolase {Ruminiclostridium thermocellum [TaxId: 637887]} encvfckiikrelpstiyyederviaikdinpaapvhvliipkehianvkeinesnaqil idihkaankvaedlgiaekgyrlitncgvaagqtvfhlhyhllggvdmgpkil
Timeline for d5uvma1: