SCOP 1.65: Domain d1esga_: 1esg A:

Lineage for d1esga_ (1esg A:)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (20 families)

5. Family c.52.1.3: Restriction endonuclease BamHI [52987] (1 protein)

6. Protein Restriction endonuclease BamHI [52988] (1 species)

7. Species Bacillus amyloliquefaciens [TaxId:1390] [52989] (5 PDB entries)

8. Domain d1esga_: 1esg A: [33286]

Details for d1esga_

PDB Entry: 1esg, 1.9 Å

PDB Description: restriction endonuclease bamhi bound to a non-specific dna.

SCOP Domain Sequences for d1esga_:

Sequence; same for both SEQRES and ATOM records:

>d1esga_ c.52.1.3 (A:) Restriction endonuclease BamHI {Bacillus amyloliquefaciens}
mevekefitdeakellskdkliqqaynevktsicspiwpatsktftinntekncngvvpi
kelcytlledtynwyrekpldilklekkkggpidvykefienselkrvgmefetgnissa
hrsmnklllglkhgeidlaiilmpikqlayyltdrvtnfeelepyfeltegqpfifigfn
aeaynsnvplipkgsdgmskrsikkwkdk

Timeline for d1esga_:

• d1esga_ first appeared (with stable ids) in SCOP 1.55
  
• d1esga_ appears in SCOP 1.63
  
• d1esga_ appears in SCOP 1.67
  
• d1esga_ appears in the current release, SCOPe 2.08