![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.82.1: ALDH-like [53720] (3 families) ![]() binds NAD differently from other NAD(P)-dependent oxidoreductases |
![]() | Family c.82.1.0: automated matches [191448] (1 protein) not a true family |
![]() | Protein automated matches [190683] (61 species) not a true protein |
![]() | Species Thermoplasma acidophilum [TaxId:2303] [332559] (1 PDB entry) |
![]() | Domain d5izdh_: 5izd H: [332852] Other proteins in same PDB: d5izda2 automated match to d4pz2a_ complexed with nap |
PDB Entry: 5izd (more details), 2.05 Å
SCOPe Domain Sequences for d5izdh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5izdh_ c.82.1.0 (H:) automated matches {Thermoplasma acidophilum [TaxId: 2303]} mdtklyidgqwvnsssgktvdkyspvtgqvigrfeaatrddvdraidaaedafwawndlg sverskiiyrakelieknraeleniimeengkpvkeakeevdgvidqiqyyaewarklng evvegtsshrkifqykvpygivvaltpwnfpagmvarklapalltgntvvlkpssdtpgs aewivrkfveagvpkgvlnfitgrgseigdyivehkkvnlitmtgstatgqrimqkasan maklilelggkapfmvwkdadmdnalktllwakywnagqsciaaerlyvhediydtfmsr fvelsrklalgdpknadmgplinkgalqatseiveeakesgakilfggsqpslsgpyrng yfflptiignadqkskifqeeifapvigarkissveemydlandskyglasylftkdpni ifeaserirfgelyvnmpgpeasqgyhtgfrmtgqagegskygiseylklkniyvdysgk plhintvrddlf
Timeline for d5izdh_: