Lineage for d2rveb_ (2rve B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2490159Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2490160Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2490176Family c.52.1.2: Restriction endonuclease EcoRV [52984] (1 protein)
    automatically mapped to Pfam PF09233
  6. 2490177Protein Restriction endonuclease EcoRV [52985] (1 species)
  7. 2490178Species Escherichia coli [TaxId:562] [52986] (30 PDB entries)
  8. 2490236Domain d2rveb_: 2rve B: [33284]
    protein/DNA complex

Details for d2rveb_

PDB Entry: 2rve (more details), 3 Å

PDB Description: the crystal structure of ecorv endonuclease and of its complexes with cognate and non-cognate dna segments
PDB Compounds: (B:) protein (eco rv (e.c.3.1.21.4))

SCOPe Domain Sequences for d2rveb_:

Sequence, based on SEQRES records: (download)

>d2rveb_ c.52.1.2 (B:) Restriction endonuclease EcoRV {Escherichia coli [TaxId: 562]}
slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy

Sequence, based on observed residues (ATOM records): (download)

>d2rveb_ c.52.1.2 (B:) Restriction endonuclease EcoRV {Escherichia coli [TaxId: 562]}
slrsdlinalyvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgyiveepkq
qnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntknivypfdqy
iahwiigyvytrtyninelneipkpykgvkvflqdkwviagdlagstnigsihahykdfv
egkgifdsedefldywrnyeynniseyrnwiy

SCOPe Domain Coordinates for d2rveb_:

Click to download the PDB-style file with coordinates for d2rveb_.
(The format of our PDB-style files is described here.)

Timeline for d2rveb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2rvea_