SCOPe 2.07: Domain d5jvja3: 5jvj A:516-874

Lineage for d5jvja3 (5jvj A:516-874)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families)

5. Family c.1.12.0: automated matches [191427] (1 protein)
   not a true family

6. Protein automated matches [190614] (15 species)
   not a true protein

7. Species Flaveria trinervia [TaxId:4227] [332556] (3 PDB entries)

8. Domain d5jvja3: 5jvj A:516-874 [332825]
   Other proteins in same PDB: d5jvja1, d5jvja2, d5jvjb1, d5jvjb2
   automated match to d1vbga1
   complexed with mg, pep

Details for d5jvja3

PDB Entry: 5jvj, 2.9 Å

PDB Description: c4-type pyruvate phosphate dikinase: different conformational states of the nucleotide binding domain in the dimer

PDB Compounds: (A:) Pyruvate, phosphate dikinase, chloroplastic

SCOPe Domain Sequences for d5jvja3:

Sequence; same for both SEQRES and ATOM records:

>d5jvja3 c.1.12.0 (A:516-874) automated matches {Flaveria trinervia [TaxId: 4227]}
pamsndleifmswadqarrlkvmanadtpndaltarnngaqgiglcrtehmffasderik
avrkmimavtpeqrkvaldlllpyqrsdfegiframdglpvtirlldpplheflpegdle
hivnelavdtgmsadeiyskienlsevnpmlgfrgcrlgisypeltemqvraifqaavsm
tnqgvtvipeimvplvgtpqelrhqisvirgvaanvfaemgvtleykvgtmieipraali
aeeigkeadffsfgtndltqmtfgysrddvgkflqiylaqgilqhdpfevidqkgvgqli
kmatekgraanpslkvgicgehggepssvaffdgvgldyvscspfrvpiarlaaaqviv

Timeline for d5jvja3:

• d5jvja3 first appeared in SCOPe 2.06
  
• d5jvja3 appears in the current release, SCOPe 2.08