SCOPe 2.07: Domain d5ukkg_: 5ukk G:

Lineage for d5ukkg_ (5ukk G:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold

4. Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family)
   long alpha-helix interrupted in the middle
   automatically mapped to Pfam PF00631

5. Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (2 proteins)

6. Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [48673] (56 PDB entries)

8. Domain d5ukkg_: 5ukk G: [332821]
   Other proteins in same PDB: d5ukka1, d5ukka2, d5ukka3, d5ukkb_
   automated match to d2bcjg_
   complexed with 8dj, mg

Details for d5ukkg_

PDB Entry: 5ukk, 2.6 Å

PDB Description: human grk2 in complex with human g-beta-gamma subunits and ccg211998 (14ak)

PDB Compounds: (G:) Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2

SCOPe Domain Sequences for d5ukkg_:

Sequence; same for both SEQRES and ATOM records:

>d5ukkg_ a.137.3.1 (G:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus) [TaxId: 9913]}
siaqarklveqlkmeanidrikvskaaadlmayceahakedplltpvpasenpfrek

Timeline for d5ukkg_:

• d5ukkg_ first appeared in SCOPe 2.06
  
• d5ukkg_ appears in the current release, SCOPe 2.08