Lineage for d4rvec_ (4rve C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2490159Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2490160Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2490176Family c.52.1.2: Restriction endonuclease EcoRV [52984] (1 protein)
    automatically mapped to Pfam PF09233
  6. 2490177Protein Restriction endonuclease EcoRV [52985] (1 species)
  7. 2490178Species Escherichia coli [TaxId:562] [52986] (30 PDB entries)
  8. 2490239Domain d4rvec_: 4rve C: [33282]
    protein/DNA complex

Details for d4rvec_

PDB Entry: 4rve (more details), 3 Å

PDB Description: the crystal structure of ecorv endonuclease and of its complexes with cognate and non-cognate dna segments
PDB Compounds: (C:) protein (eco rv (e.c.3.1.21.4))

SCOPe Domain Sequences for d4rvec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rvec_ c.52.1.2 (C:) Restriction endonuclease EcoRV {Escherichia coli [TaxId: 562]}
slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy

SCOPe Domain Coordinates for d4rvec_:

Click to download the PDB-style file with coordinates for d4rvec_.
(The format of our PDB-style files is described here.)

Timeline for d4rvec_: