Lineage for d5j13b2 (5j13 B:113-216)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. Protein automated matches [190374] (15 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1239 PDB entries)
  8. Domain d5j13b2: 5j13 B:113-216 [332787]
    Other proteins in same PDB: d5j13b1
    automated match to d1adql2
    complexed with so4

Details for d5j13b2

PDB Entry: 5j13 (more details), 2.3 Å

PDB Description: structural basis for tslp antagonism by the therapeutic antibody tezepelumab (medi9929 / amg-157)
PDB Compounds: (B:) anti-TSLP Fab-fragment, light chain

SCOPe Domain Sequences for d5j13b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j13b2 b.1.1.2 (B:113-216) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptec

SCOPe Domain Coordinates for d5j13b2 are not available.

Timeline for d5j13b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5j13b1