Lineage for d5thca_ (5thc A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2385148Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2385149Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2385894Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2385895Protein automated matches [227017] (57 species)
    not a true protein
  7. 2386336Species Influenza A virus, different strains [TaxId:11320] [228462] (34 PDB entries)
  8. 2386423Domain d5thca_: 5thc A: [332782]
    Other proteins in same PDB: d5thcb_, d5thcd_, d5thcf_
    automated match to d4d00c_
    complexed with bma, gal, man, nag, sia; mutant

Details for d5thca_

PDB Entry: 5thc (more details), 2.79 Å

PDB Description: crystal structure of h10 hemagglutinin mutant (t193d-q226l-g228s) from jiangxi-donghu (2013) h10n8 influenza virus in complex with 6'-slnln
PDB Compounds: (A:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d5thca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5thca_ b.19.1.0 (A:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
dkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpigml
igtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgftygss
insagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhpss
tqekntlygtqslsisvgsstyrnnfvpvvgarpqvnglssridfhwtlvqpgdnitfsh
nggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcpk
yvnrrslmlatgmrnvpe

SCOPe Domain Coordinates for d5thca_:

Click to download the PDB-style file with coordinates for d5thca_.
(The format of our PDB-style files is described here.)

Timeline for d5thca_: