SCOPe 2.08: Domain d5v4db1: 5v4d B:2-126

Lineage for d5v4db1 (5v4d B:2-126)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.1: YjgF-like [55298] (4 families)
   forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.1.0: automated matches [191544] (1 protein)
   not a true family

6. Protein automated matches [190935] (24 species)
   not a true protein

7. Species Yersinia pestis [TaxId:632] [332774] (1 PDB entry)

8. Domain d5v4db1: 5v4d B:2-126 [332775]
   Other proteins in same PDB: d5v4da2, d5v4db2, d5v4dc2, d5v4dd2, d5v4de2, d5v4df2
   automated match to d3v4da_
   complexed with acy, ca, gol

Details for d5v4db1

PDB Entry: 5v4d, 1.6 Å

PDB Description: crystal structure of the protein of unknown function of the conserved rid protein family yyfa from yersinia pestis

PDB Compounds: (B:) Putative translational inhibitor protein

SCOPe Domain Sequences for d5v4db1:

Sequence; same for both SEQRES and ATOM records:

>d5v4db1 d.79.1.0 (B:2-126) automated matches {Yersinia pestis [TaxId: 632]}
ksvietknapsaigpysqaicfngilyasgqipinpdtgdlvendiekqtrqvlknidav
llqagttkdkivkttifitninnssqvndiyadyfkgtifparstvevsalpkgalveie
viagv

Timeline for d5v4db1:

• d5v4db1 first appeared in SCOPe 2.06
  
• d5v4db1 appears in SCOPe 2.07