SCOPe 2.06: Domain d5thba_: 5thb A:

Lineage for d5thba_ (5thb A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (34 species)
   not a true protein

7. Species Influenza A virus [TaxId:11320] [228462] (22 PDB entries)

8. Domain d5thba_: 5thb A: [332764]
   Other proteins in same PDB: d5thbb_, d5thbd_, d5thbf_
   automated match to d4d00c_
   complexed with bma, man, nag; mutant

Details for d5thba_

PDB Entry: 5thb, 2.41 Å

PDB Description: crystal structure of h10 hemagglutinin mutant (t193d-q226l-g228s) from jiangxi-donghu (2013) h10n8 influenza virus

PDB Compounds: (A:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d5thba_:

Sequence; same for both SEQRES and ATOM records:

>d5thba_ b.19.1.0 (A:) automated matches {Influenza A virus [TaxId: 11320]}
dkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpigml
igtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgftygss
insagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhpss
tqekntlygtqslsisvgsstyrnnfvpvvgarpqvnglssridfhwtlvqpgdnitfsh
nggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcpk
yvnrrslmlatgmrnvpe

Timeline for d5thba_:

• d5thba_ is new in SCOPe 2.06-stable
  
• d5thba_ appears in SCOPe 2.07
  
• d5thba_ appears in the current release, SCOPe 2.08