Lineage for d5tgof_ (5tgo F:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3041482Protein automated matches [254646] (29 species)
    not a true protein
  7. 3041677Species Influenza A virus, different strains [TaxId:11320] [255822] (26 PDB entries)
  8. 3041700Domain d5tgof_: 5tgo F: [332758]
    Other proteins in same PDB: d5tgoa_, d5tgoc_, d5tgoe_
    automated match to d3m5jb_
    complexed with nag; mutant

Details for d5tgof_

PDB Entry: 5tgo (more details), 2.35 Å

PDB Description: crystal structure of h10 hemagglutinin mutant (k158aa-d193t-q226l- g228s) from jiangxi-donghu (2013) h10n8 influenza virus
PDB Compounds: (F:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d5tgof_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tgof_ h.3.1.1 (F:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
lfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektnt
efesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlyer
vrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln

SCOPe Domain Coordinates for d5tgof_:

Click to download the PDB-style file with coordinates for d5tgof_.
(The format of our PDB-style files is described here.)

Timeline for d5tgof_: