SCOPe 2.08: Domain d5thcd_: 5thc D:

Lineage for d5thcd_ (5thc D:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (29 species)
   not a true protein

7. Species Influenza A virus, different strains [TaxId:11320] [255822] (26 PDB entries)

8. Domain d5thcd_: 5thc D: [332757]
   Other proteins in same PDB: d5thca_, d5thcc_, d5thce_
   automated match to d3m5jb_
   complexed with nag, sia; mutant

Details for d5thcd_

PDB Entry: 5thc, 2.79 Å

PDB Description: crystal structure of h10 hemagglutinin mutant (t193d-q226l-g228s) from jiangxi-donghu (2013) h10n8 influenza virus in complex with 6'-slnln

PDB Compounds: (D:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d5thcd_:

Sequence; same for both SEQRES and ATOM records:

>d5thcd_ h.3.1.1 (D:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
lfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektnt
efesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlyer
vrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln

Timeline for d5thcd_:

• d5thcd_ first appeared in SCOPe 2.06
  
• d5thcd_ appears in SCOPe 2.07