Lineage for d1rvea_ (1rve A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2121131Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2121132Superfamily c.52.1: Restriction endonuclease-like [52980] (36 families) (S)
  5. 2121148Family c.52.1.2: Restriction endonuclease EcoRV [52984] (1 protein)
    automatically mapped to Pfam PF09233
  6. 2121149Protein Restriction endonuclease EcoRV [52985] (1 species)
  7. 2121150Species Escherichia coli [TaxId:562] [52986] (30 PDB entries)
  8. 2121205Domain d1rvea_: 1rve A: [33274]
    protein/DNA complex

Details for d1rvea_

PDB Entry: 1rve (more details), 2.5 Å

PDB Description: the crystal structure of ecorv endonuclease and of its complexes with cognate and non-cognate dna fragments
PDB Compounds: (A:) ENDONUCLEASE EcoR V

SCOPe Domain Sequences for d1rvea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rvea_ c.52.1.2 (A:) Restriction endonuclease EcoRV {Escherichia coli [TaxId: 562]}
slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy
rgrk

SCOPe Domain Coordinates for d1rvea_:

Click to download the PDB-style file with coordinates for d1rvea_.
(The format of our PDB-style files is described here.)

Timeline for d1rvea_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1rveb_