SCOPe 2.08: Domain d5ja9b1: 5ja9 B:2-117

Lineage for d5ja9b1 (5ja9 B:2-117)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)

8. Domain d5ja9b1: 5ja9 B:2-117 [332735]
   Other proteins in same PDB: d5ja9a2, d5ja9b2
   automated match to d5h8da_
   complexed with edo, so4

Details for d5ja9b1

PDB Entry: 5ja9, 1.85 Å

PDB Description: crystal structure of the higb2 toxin in complex with nb6

PDB Compounds: (B:) Nanobody 6

SCOPe Domain Sequences for d5ja9b1:

Sequence; same for both SEQRES and ATOM records:

>d5ja9b1 b.1.1.1 (B:2-117) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlqesggglvqpggslrlscaasgftfsnyamrwyrqapgeerefvafissvggstny
adsvkgrftisrdngkntlylqmnslkpedtavyfcvarlslisdswgqgtqvtvs

Timeline for d5ja9b1:

• d5ja9b1 first appeared in SCOPe 2.06
  
• d5ja9b1 appears in SCOPe 2.07