| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) ![]() |
| Family d.92.1.0: automated matches [191495] (1 protein) not a true family |
| Protein automated matches [190805] (20 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188286] (69 PDB entries) |
| Domain d5mj6b2: 5mj6 B:367-615 [332731] Other proteins in same PDB: d5mj6a1, d5mj6a3, d5mj6a4, d5mj6a5, d5mj6b1, d5mj6b3, d5mj6b4, d5mj6b5 automated match to d4pj6a2 complexed with 7o2, br, nag, zn |
PDB Entry: 5mj6 (more details), 2.53 Å
SCOPe Domain Sequences for d5mj6b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mj6b2 d.92.1.0 (B:367-615) automated matches {Human (Homo sapiens) [TaxId: 9606]}
knlsqdvngtlvsiyavpekigqvhyalettvklleffqnyfeiqyplkkldlvaipdfe
agamenwglltfreetllydsntssmadrklvtkiiahelahqwfgnlvtmkwwndlwln
egfatfmeyfslekifkelssyedfldarfktmkkdslnsshpisssvqsseqieemfds
lsyfkgsslllmlktylsedvfqhavvlylhnhsyasiqsddlwdsfnevtnqtldvkrm
mktwtlqkg
Timeline for d5mj6b2: